DPCfam | MC131616
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 109 ± 23 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01493 |
| Sequences matching dominant architecture (%) | 99.66 |
| Average overlap percent | 57.63 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D3TCK0 | 1792-1895 | 104 | IKNTDRAVGAMLSYHIIQKYGEQGLPIDTINVKFRGTGGLSFGVFLTSGVNFELEGDANDFVGKGLSGGIISVHFPKNSLFINEC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6NFK0-F1 | 1410-1537 | 98.46 | 96.14 | View in AlphaFoldDB ↗ |