DPCfam | MC1316
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 163 ± 23 aa |
| Residues in low-complexity regions (%) | 3.62 |
| Residues in coiled-coil regions (%) | 3.81 |
| Predicted disordered residues (%) | 37.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06758 |
| Sequences matching dominant architecture (%) | 13.33 |
| Average overlap percent | 8.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000698F6EA | 629-791 | 163 | SPSQKPEQYSALGGSATMKEACAQGLSNGEFSSHFSELQASQAQVESRIQGNPRLGIQLCQYFDYPDCKARLSLSSATWGFAAST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96M43-F1 | 458-619 | 98.79 | 37.43 | View in AlphaFoldDB ↗ |