DPCfam | MC131396
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 278 ± 46 aa |
| Residues in low-complexity regions (%) | 4.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.34 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00168 |
| Sequences matching dominant architecture (%) | 0.65 |
| Average overlap percent | 54.04 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K1RIN0 | 238-522 | 285 | FFTMTSFPVGFIIHLGGVVSAKSVKLLDKIHNPEEPETRDAWWTEIRTEIRTHCRTMGCHAVLGYTEHTTICDEIIVLCATGTAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IMW9-F1 | 855-1149 | 99.66 | 75.85 | View in AlphaFoldDB ↗ |