DPCfam | MC131169
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Residues in low-complexity regions (%) | 0.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18804 |
| Sequences matching dominant architecture (%) | 50.67 |
| Average overlap percent | 11.77 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A162RB84 | 130-254 | 125 | WKTRMDTQDQLWSKNRTSLHQSIVESLPLCKQAACSNCRGVGSTPVKCQTCRTYLCAACDKIVHSKTVTHQRVCEVKDSLHQMLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7WBK7-F1 | 11-55 | 34.11 | 88.97 | View in AlphaFoldDB ↗ |