DPCfam | MC131109
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.54 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00853 |
| Sequences matching dominant architecture (%) | 97.3 |
| Average overlap percent | 91.56 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094F2339 | 43-179 | 137 | KIQGEHPGEQFAPTGSPYILCSKLPEHWRSNKTLPMGFRVIAATEVLDGTKVVVQAGNDENCTAEMRNYSAVMKNGEAKFNDLRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B3DKD9-F1 | 72-193 | 97.60 | 96.57 | View in AlphaFoldDB ↗ |