DPCfam | MC130784
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Residues in low-complexity regions (%) | 0.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09614 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 33.51 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167P586 | 235-317 | 83 | KWQYLKKPFNGYLVPIMAGYKAIAQPLTKEEVLGLRVKPDPEDQDVKAVAFVEAVHSVAEWISMHKVVQLSDYVWRYHQDGEW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q02MM0-F1 | 238-317 | 96.43 | 91.07 | View in AlphaFoldDB ↗ |