DPCfam | MC130706
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Residues in low-complexity regions (%) | 0.47 |
| Residues in coiled-coil regions (%) | 0.28 |
| Predicted disordered residues (%) | 11.64 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14806 |
| Sequences matching dominant architecture (%) | 49.48 |
| Average overlap percent | 52.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146ZIP1 | 458-539 | 82 | VYQLSSGTPVLVVLNEMKIDVVDFARLPTKTITDAEFRKMWSKLEWENKINVLAPSGLSMDAYLKNVINITKMRLLTIERVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9JIF7-F1 | 814-881 | 98.55 | 85.53 | View in AlphaFoldDB ↗ |