DPCfam | MC130574
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 723 ± 128 aa |
| Residues in low-complexity regions (%) | 2.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.75 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF07992 |
| Sequences matching dominant architecture (%) | 23.53 |
| Average overlap percent | 39.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0EGL6 | 185-1034 | 850 | SLDFVERAFELFPDREYLILTQPYTVQETTLLSHFLQVSRKKHSTFEHVLYIFHRNSLDSHLIELRKFNQSEWNQCQFLVENLLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CEL2-F1 | 421-1189 | 99.47 | 86.84 | View in AlphaFoldDB ↗ |