DPCfam | MC130378
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 17.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009B419D6 | 1590-1711 | 122 | LRKKQRDALVVHLTHMLDNKGQPLYGETMEKLFEHLLLDPGMEPVVLASRIQLAISSVQLFVQRCLMNLEPDAVDPQIIDTTRWE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6A878-F1 | 6-136 | 99.22 | 87.23 | View in AlphaFoldDB ↗ |