DPCfam | MC130076
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 494 ± 53 aa |
| Residues in low-complexity regions (%) | 1.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00094 |
| Sequences matching dominant architecture (%) | 69.57 |
| Average overlap percent | 22.6 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6HCW2 | 3757-4286 | 530 | CTYLLARDFLTHNFTLAVQYVSSRGKPYASVLQLLVDDVQWDLDLANRTVRANGITQMLPTFGSRTERGTAAFYENGKLVIESFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9Q0B5-F1 | 1660-1920 | 47.67 | 80.70 | View in AlphaFoldDB ↗ |