DPCfam | MC130035
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Residues in low-complexity regions (%) | 1.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06560 |
| Sequences matching dominant architecture (%) | 97.73 |
| Average overlap percent | 23.49 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G2LCA6 | 8-106 | 99 | LTANAFDEPLVMANWIRDDFAYDYGPYRALRGGGYRIICGSVPDTIEFEENGNYREVPELVKLRPREVPGLGLTRSRPLYALSGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZMP7-F1 | 157-262 | 99.07 | 96.76 | View in AlphaFoldDB ↗ |