DPCfam | MC129978
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 254 ± 24 aa |
| Residues in low-complexity regions (%) | 3.95 |
| Residues in coiled-coil regions (%) | 0.35 |
| Predicted disordered residues (%) | 5.03 |
| Average transmembrane regions | 4.98 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146WTX2 | 1135-1374 | 240 | DIKDPLPEKLQSSMKEILLSDLVVCSVAYILTFAITASTVFLSLKPFVTIVLYALAGTVGFVTHYLIPQLRKHHPWLWISHPVLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q98UF7-F1 | 655-909 | 99.61 | 84.99 | View in AlphaFoldDB ↗ |