DPCfam | MC129309
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 312 ± 33 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13091 |
| Sequences matching dominant architecture (%) | 8.21 |
| Average overlap percent | 33.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L7UDP6 | 24-387 | 364 | SAVFTTFRFEPGFFEAEVLPVFFDIALSHAPAIKLVQLEEALVSLPGSIAVYYDAHGLVAEGGTAKLDTRRIPIRHPTGIFHPKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7V5T6-F1 | 330-442 | 39.48 | 95.76 | View in AlphaFoldDB ↗ |