DPCfam | MC129170
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 72 ± 9 aa |
| Residues in low-complexity regions (%) | 2.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09341 |
| Sequences matching dominant architecture (%) | 1.33 |
| Average overlap percent | 1.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S4RNG3 | 139-211 | 73 | KCSGIKKVEYLALDLQRSTSPNPPRKQKSTVMVAVVPSESRVDYVEVDQEKTRALQSTRQAWTDVRQSSESET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UQC2-F1 | 592-672 | 100.00 | 60.10 | View in AlphaFoldDB ↗ |