DPCfam | MC12902
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Residues in low-complexity regions (%) | 9.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.36 |
| Average transmembrane regions | 1.76 |
| Dominant Pfam architecture(s) | PF00999 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 22.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M4GMD8 | 225-293 | 69 | LGTRGTFALILLFVVLAEALGAEAILGAFLAGVIVSLLSPSKDFIHQLDSFGYGFLIPIFFIMIGVNLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FZQ4-F1 | 225-304 | 98.80 | 87.38 | View in AlphaFoldDB ↗ |