DPCfam | MC129005
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Residues in low-complexity regions (%) | 7.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.58 |
| Average transmembrane regions | 1.11 |
| Dominant Pfam architecture(s) | PF00689- PF12424 |
| Sequences matching dominant architecture (%) | 67.39 |
| Average overlap percent | 46.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7UZC8 | 978-1104 | 127 | FIAQIVIIQIGGYAFATAPLTIDQWMWCFFFGVGVLLWGQLVTTIPTNRLPHSMTLGSATKEEIELIEQDDQFDEEGLNADDMGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59DP9-F1 | 1001-1121 | 99.17 | 64.69 | View in AlphaFoldDB ↗ |