DPCfam | MC12898
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Residues in low-complexity regions (%) | 7.54 |
| Residues in coiled-coil regions (%) | 45.96 |
| Predicted disordered residues (%) | 15.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D2UIT7 | 2-70 | 69 | SIQAEGDSLAILKADLKSQRKQVRNLKKKSLWSRSLEEVMEKLVDIVHYLILEIHCAIGSNEYQKSPEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9XID5-F1 | 309-364 | 96.55 | 92.29 | View in AlphaFoldDB ↗ |