DPCfam | MC128894
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Residues in low-complexity regions (%) | 2.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.39 |
| Average transmembrane regions | 2.9 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D1XHM1 | 61-169 | 109 | PPALNYTLRTRIKSLVWFWTLIFIDCVCVPIVLYFCLWNLTDLSHNAVFSISTGTLGTVSIVEYFIRFRRLWRKGSDCRVIGARR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WG93-F1 | 42-161 | 94.49 | 83.94 | View in AlphaFoldDB ↗ |