DPCfam | MC12885
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 170 ± 11 aa |
| Residues in low-complexity regions (%) | 2.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.13 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08819 |
| Sequences matching dominant architecture (%) | 98.91 |
| Average overlap percent | 96.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F4QI71 | 6-184 | 179 | ATNAALKEWAIVCRALADGRQTILIRKGGIQEIKDGFEVMHRDFWLFPTYVHQKATDLVPTVREKFQSIQAEQSAPGTLSIHLYA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6X5G8-F1 | 4-168 | 96.57 | 89.86 | View in AlphaFoldDB ↗ |