DPCfam | MC128367
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 249 ± 22 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02893- PF03033 |
| Sequences matching dominant architecture (%) | 85.99 |
| Average overlap percent | 75.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167SNL3 | 993-1288 | 296 | DDELDDDVGVSGPDLVASNERFRAHFALPSTERLQATYFGYLMRVLPLYGKIYISERSFCFRSLLPGTRTKLILPLKDIENVTKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C4B4E5-F1 | 795-1041 | 99.19 | 80.25 | View in AlphaFoldDB ↗ |