DPCfam | MC128193
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 519 ± 38 aa |
| Residues in low-complexity regions (%) | 2.74 |
| Residues in coiled-coil regions (%) | 0.97 |
| Predicted disordered residues (%) | 17.96 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF13910 |
| Sequences matching dominant architecture (%) | 74.73 |
| Average overlap percent | 16.06 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X5YI30 | 63-605 | 543 | LSALEVLRQISTYHFVPDDRIEPFRPLAIMGGRRSPIPADLLSDQIVILAELVPDIGHHAFRARVADVCWLLNEKDAASGLRAVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I3X4-F1 | 70-601 | 99.61 | 93.00 | View in AlphaFoldDB ↗ |