DPCfam | MC128114
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Residues in low-complexity regions (%) | 1.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3XBL7 | 444-535 | 92 | ALHNLRYLSGVHKCIECYSEVKDFASHFPAYVHCSLCRYNTSCSKAYVNHMMRGVTVVCLNCDFLTDVSGLDSMATHLSESHTHT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M0V0-F1 | 620-720 | 98.00 | 77.98 | View in AlphaFoldDB ↗ |