DPCfam | MC12811
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13640 |
| Sequences matching dominant architecture (%) | 0.51 |
| Average overlap percent | 47.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L8HK39 | 268-353 | 86 | RTRDLYEGLCQTLGSQPTSYEDPNMLCMYDTSRHPHLVLQPMKKEIVSLHPLVVLYHDFVSDSEAETIKDLASPWLHRSVVASGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZAS3-F1 | 306-398 | 100.00 | 80.16 | View in AlphaFoldDB ↗ |