DPCfam | MC128051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 364 ± 63 aa |
| Residues in low-complexity regions (%) | 6.72 |
| Residues in coiled-coil regions (%) | 9.35 |
| Predicted disordered residues (%) | 41.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15739 |
| Sequences matching dominant architecture (%) | 97.37 |
| Average overlap percent | 28.19 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3JUG3 | 13-495 | 483 | LNELLEQVVVAHRKDIMDYSGGHLNESKLHKPPEMATFKSWPSAHAGQLTMKQKHVLAKPKRGLQNKSEMEKAIMDFSVGTSGAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5T5N4-F1 | 40-436 | 100.00 | 72.42 | View in AlphaFoldDB ↗ |