DPCfam | MC127941
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 534 ± 70 aa |
| Residues in low-complexity regions (%) | 2.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.9 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF01494- PF00307 |
| Sequences matching dominant architecture (%) | 30.43 |
| Average overlap percent | 82.74 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060W9L6 | 19-487 | 469 | ILFDRFVQASTCKVTLKAFQELCDHLELKPCEYRVFYHKLKSRLNYWKAKALWAKLDKRAGQKEYKKGRACTNSKCLIIGAGPCG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QH17-F1 | 20-476 | 100.00 | 92.85 | View in AlphaFoldDB ↗ |