DPCfam | MC127892
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Residues in low-complexity regions (%) | 0.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.15 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF01682 |
| Sequences matching dominant architecture (%) | 0.99 |
| Average overlap percent | 1.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183CM08 | 1-60 | 60 | MSGNPKKVEKRLKEIFVSDDVLFGVFAFVSLFELGLIMALVSDRFDALVDTHFKSRKWAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5S6PE56-F1 | 89-122 | 57.63 | 90.29 | View in AlphaFoldDB ↗ |