DPCfam | MC127866
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Residues in low-complexity regions (%) | 15.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 58.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J1IAK8 | 908-985 | 78 | EESRPKSTNLVKIDTDVTITGVYVNSVSSQETICKTLKYRTAYSVTEECVVSRPPTQEPPKSYTPLSALTNMRPPGGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VWC0-F1 | 986-1071 | 100.00 | 34.53 | View in AlphaFoldDB ↗ |