DPCfam | MC127715
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 56.15 |
| Predicted disordered residues (%) | 37.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00615 |
| Sequences matching dominant architecture (%) | 2.63 |
| Average overlap percent | 68.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B6ZGH7 | 38-136 | 99 | FDDGEESLIAGQSYHAQQLLRALDSKITNKARALRAQKTSQKTDGNNKLKRVQEDMEHELENLKKERRLLEMHIARTQKWIDNIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9H3E2-F1 | 425-518 | 97.92 | 74.47 | View in AlphaFoldDB ↗ |