DPCfam | MC127665
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 191 ± 21 aa |
| Residues in low-complexity regions (%) | 0.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06335 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 97.74 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S0L4D5 | 3-194 | 192 | RFTKESFAVFQVEGLEARMEAIREDVQPVFATLGQKISDYLTQKTGEIYYVHIAQHRRRTIHAPDNTWVAIGRNKRGYKMEAHFQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ER92-F1 | 3-197 | 100.00 | 96.92 | View in AlphaFoldDB ↗ |