DPCfam | MC127657
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 721 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Residues in low-complexity regions (%) | 2.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.03 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04430 |
| Sequences matching dominant architecture (%) | 97.6 |
| Average overlap percent | 93.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DDF08C | 29-158 | 130 | YGNGAFRFLELRHAGGLCILPSGIYAWPRQHFDEVREEDFTPAFELIARMNARADPFAFDQPSPQESDAHVDFVLFGLGEQHRPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O08776-F1 | 61-169 | 100.00 | 95.62 | View in AlphaFoldDB ↗ |