DPCfam | MC127575
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Residues in low-complexity regions (%) | 8.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.2 |
| Average transmembrane regions | 3.02 |
| Dominant Pfam architecture(s) | PF12801 |
| Sequences matching dominant architecture (%) | 0.7 |
| Average overlap percent | 15.67 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E7QR95 | 17-133 | 117 | ARAFAPTVLPIAAAYEVAHNYTYVFRNLGQLVAVALEPVAPGVQAVNPLGWLSLPAFWGSQVLLIVLGHVIAVVAAHYVAVERFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F481-F1 | 307-444 | 95.89 | 90.47 | View in AlphaFoldDB ↗ |