DPCfam | MC127398
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 98 ± 5 aa |
| Residues in low-complexity regions (%) | 7.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08314 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 18.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J4UJD3 | 4-103 | 100 | SITPAKVLLLAAYLAAQGDIDKLASLALHNAHVLHIEILLRVILTYLPETAEPCAYTEFLRDLSDGQLRAPAHFELDTSSVDILN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VZE7-F1 | 5-101 | 96.04 | 89.56 | View in AlphaFoldDB ↗ |