DPCfam | MC127390
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Residues in low-complexity regions (%) | 2.79 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 33.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04082 |
| Sequences matching dominant architecture (%) | 70.27 |
| Average overlap percent | 4.37 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B2AME6 | 172-263 | 92 | AGMILSDLRYVDASHWESILSDVLSITGSLDRPEDVFQDDDDPIVPPKPERQGQPDLLLGGWPRLSVEELVRYLPPRAIADRLLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0E4AZF8-F1 | 155-248 | 96.94 | 80.30 | View in AlphaFoldDB ↗ |