DPCfam | MC12730
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 519 ± 30 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.67 |
| Average transmembrane regions | 0.26 |
| Dominant Pfam architecture(s) | PF12804- PF01633 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 87.75 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M0WVK7 | 9-511 | 503 | VILASGYSNAFDIPPCLLKVDHQTLIKRTVNILKDRNIHEIFIIVGYKKDLIIEELENENVNFIINSIYTSTGTMKSLSLLKKYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DPI4-F1 | 4-277 | 53.98 | 95.42 | View in AlphaFoldDB ↗ |