DPCfam | MC127256
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Residues in low-complexity regions (%) | 2.69 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 0.65 |
| Average transmembrane regions | 2.48 |
| Dominant Pfam architecture(s) | PF00115 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 34.31 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W1IA57 | 94-217 | 124 | KVAWAAVALWLIGCLCVVATLPFGMTQAKEYHEAEWWIDLILAASWVCMTISFLATIAARKMSHIYVGLWFFMTMLFMVTYIFVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I3G0-F1 | 105-222 | 100.00 | 98.31 | View in AlphaFoldDB ↗ |