DPCfam | MC127227
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 154 ± 18 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J2JP64 | 23-165 | 143 | LKSNSLLIESDRELQFFHQTFYDYTFSRQFVESKKSLEKYIKENSQSLYVRSVIKMVIEYYREYDHKEYIRLLRVLVTSASYRFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NYH5-F1 | 927-1003 | 49.37 | 80.48 | View in AlphaFoldDB ↗ |