DPCfam | MC127031
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 5.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15479 |
| Sequences matching dominant architecture (%) | 95.24 |
| Average overlap percent | 42.46 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9KSP1 | 6-76 | 71 | IPKSRLDKARNPPSQAMTPIPPIAVDIIPGRFTEADWYSLLQTEEGEVHVASIVEELTDRAMKDIFNIYLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A140LFY6-F1 | 1-80 | 98.70 | 80.50 | View in AlphaFoldDB ↗ |