DPCfam | MC126957
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Residues in low-complexity regions (%) | 0.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10293 |
| Sequences matching dominant architecture (%) | 94.32 |
| Average overlap percent | 77.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3L337 | 1372-1465 | 94 | IEGDAARLRIPFKFVIAEVIENVSLLVKTTKQLIYQFIHGGTGSVLQPEVEAPKRLPEIRIKFRIVCVQAEDDPFENKLNAIRRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q06179-F1 | 942-1099 | 97.95 | 79.63 | View in AlphaFoldDB ↗ |