DPCfam | MC126661
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Residues in low-complexity regions (%) | 11.51 |
| Residues in coiled-coil regions (%) | 13.22 |
| Predicted disordered residues (%) | 22.47 |
| Average transmembrane regions | 0.41 |
| Dominant Pfam architecture(s) | PF11382 |
| Sequences matching dominant architecture (%) | 99.06 |
| Average overlap percent | 49.04 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V8CZ59 | 11-130 | 120 | VISLRQHAISLVAVFLALAVGVVLGSGFVADTFGSSSDAQDEREQQLRDENQQLSSNLNAANNFDAAIAGRLLGGSLKDRPVLII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EUH2-F1 | 1-126 | 99.21 | 90.94 | View in AlphaFoldDB ↗ |