DPCfam | MC126640
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 171 ± 18 aa |
| Residues in low-complexity regions (%) | 1.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.86 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13527 |
| Sequences matching dominant architecture (%) | 4.17 |
| Average overlap percent | 11.37 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U2ZJS6 | 187-333 | 147 | DMLYGRFENQYPLHAKRSGSYIQRRFLDHPTKPYQVYTLEQNGYAEGYCVLHEETKENGVSFATIVDLFGPNDEAIIADQLKAIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C7M077-F1 | 211-305 | 53.89 | 93.23 | View in AlphaFoldDB ↗ |