DPCfam | MC126429
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10462 |
| Sequences matching dominant architecture (%) | 31.43 |
| Average overlap percent | 51.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S2DMS6 | 306-396 | 91 | QTFLHETGHGYGFQHTPCGAAGDTDPDYPTYEPYASASIGEFGLDIRDGTIHEPQLISDYMSYCRPRWMSLYQHRRLLSHPRLAP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54CQ0-F1 | 296-340 | 57.69 | 95.77 | View in AlphaFoldDB ↗ |