DPCfam | MC126207
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.31 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF16693 |
| Sequences matching dominant architecture (%) | 55.93 |
| Average overlap percent | 78.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F3CAR3 | 57-181 | 125 | TQARSWLEGALQDARLTQLRVEEQGGQLSVEGAFPAAQKSSWLQIQQAFDTRFGQHIVLTPNVQASTALAAPRVRFQAVWFGRNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I318-F1 | 290-413 | 97.58 | 83.27 | View in AlphaFoldDB ↗ |