DPCfam | MC125970
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 461 ± 67 aa |
| Residues in low-complexity regions (%) | 3.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.59 |
| Average transmembrane regions | 0.22 |
| Dominant Pfam architecture(s) | PF01753 |
| Sequences matching dominant architecture (%) | 40.0 |
| Average overlap percent | 4.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000440F5C5 | 35-438 | 404 | MEHSTEYWKALIEYDDYFLRRKIWRMSRMMANVRGDLTVDEAMRPITEVLTGATMGEWAELMENGLLSIACQVVGLCAVGLVGLH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57XS7-F1 | 317-349 | 6.43 | 73.17 | View in AlphaFoldDB ↗ |