DPCfam | MC12592
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 187 ± 41 aa |
| Residues in low-complexity regions (%) | 2.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.73 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF04471 |
| Sequences matching dominant architecture (%) | 11.11 |
| Average overlap percent | 17.43 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F8DZ18 | 53-215 | 163 | VNSLIDHLISRLRAVSSGNSDAGAYHALMVGILEFIFYPNLINPVKELEINQGRKRIDISFDNGAPPDGFFYRLQHSFQIPCPYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q00042-F1 | 505-672 | 95.48 | 85.44 | View in AlphaFoldDB ↗ |