DPCfam | MC125640
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 252 ± 32 aa |
| Residues in low-complexity regions (%) | 3.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14952 |
| Sequences matching dominant architecture (%) | 98.15 |
| Average overlap percent | 15.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7VDT3 | 7-241 | 235 | KVKNILFNLGKPTLRGVRKCPKCGTLNGTRGISCKNKGCDMVFKEKDRKRGHSADAVKIITDMDGNPAENVDADVLAGAAHCYVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2RYC3-F1 | 13-262 | 99.21 | 79.08 | View in AlphaFoldDB ↗ |