DPCfam | MC125340
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 153 ± 23 aa |
| Residues in low-complexity regions (%) | 6.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.37 |
| Average transmembrane regions | 2.91 |
| Dominant Pfam architecture(s) | PF14342 |
| Sequences matching dominant architecture (%) | 98.21 |
| Average overlap percent | 30.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B1ZF50 | 30-162 | 133 | SVEVVRHPQHMTVMNVVWPVSALFGSVAVVWAYFRYGRLATMEAHHRAKERGEKPPNMTGTPFVVMVGKGALHCGSGCMLGDVAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q55B13-F1 | 152-237 | 51.32 | 77.32 | View in AlphaFoldDB ↗ |