DPCfam | MC125007
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 195 ± 24 aa |
| Residues in low-complexity regions (%) | 9.13 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 4.51 |
| Average transmembrane regions | 3.1 |
| Dominant Pfam architecture(s) | PF04654 |
| Sequences matching dominant architecture (%) | 97.05 |
| Average overlap percent | 94.65 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4C105 | 10-206 | 197 | AVFVVLIGGYHVITGYRPLVDRSIVGAVQAQRVVWMRNMAARDVRIVDAQLLASLSQGNAFFASTSAIGIGGLAAMIGSGDQVQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9LV18-F1 | 15-215 | 99.02 | 85.75 | View in AlphaFoldDB ↗ |