DPCfam | MC124979
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Residues in low-complexity regions (%) | 4.0 |
| Residues in coiled-coil regions (%) | 0.31 |
| Predicted disordered residues (%) | 15.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13580 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9ZQA5 | 4-61 | 58 | ERFFLEAEKLFETIRNTQTTAIEQAGEIIADKISNGGNVYLFDTGHIVDSEIYNRVGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5L010-F1 | 4-69 | 98.51 | 98.34 | View in AlphaFoldDB ↗ |