DPCfam | MC12493
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.42 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00502 |
| Sequences matching dominant architecture (%) | 7.55 |
| Average overlap percent | 89.45 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H8MUT7 | 14-102 | 89 | PIASASVQALYEDPFWAARYGIQRARRFGDEDAVFHVRYLVQALDASRPAILEDYARWLRTLLVTRGMCSLHLDQHFDGLARALQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EZI7-F1 | 242-337 | 97.06 | 90.98 | View in AlphaFoldDB ↗ |