DPCfam | MC124911
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 281 ± 71 aa |
| Residues in low-complexity regions (%) | 5.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.97 |
| Average transmembrane regions | 0.53 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A078F3P8 | 129-466 | 338 | KQKADEYKKQKELGADGVQEANKPSSTEKSSVRSSNKVEEENGGKKRELKVSSIDFVGLGFADKKSTRGLPPGLVPVEDYFAGGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LJA1-F1 | 137-440 | 98.70 | 76.03 | View in AlphaFoldDB ↗ |